EGF, rat recombinant

INQUIRY

CAT. NO.: APE-017

Product Details
Alternate Name	Urogastrone, URG, EGF, epidermal growth factor
Gene Symbol	EGF
Gene ID	6075
Source	E. coli
Appearance	Lyophilized protein
Physical Form Description	Lyophilized from PBS, pH 7.4
Molecular Weight	6.151 kDa
Purity by SDS-PAGE	≥98%
Amino Acid Sequence	NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Handling	Centrifuge the vial prior to opening.
Storage Conditions	-20°C

Description
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coliis a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.

Description

Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coliis a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.

Our customers have direct access to our experts and give timely feedback to any online inquiries. If you are interested in our products, please contact us.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.